CJC-1295 with DAC
Long-Acting Growth Hormone Releasing Hormone Analog · Extended Release
Modified growth hormone releasing hormone engineered for extended duration via albumin-binding technology. DAC binds to albumin, extending half-life and providing continuous GHRH receptor stimulation.
Overview
Modified growth hormone releasing hormone engineered for extended duration via albumin-binding technology. DAC binds to albumin, extending half-life and providing continuous GHRH receptor stimulation.
DAC binds to albumin, extending half-life to 6-8 days and providing continuous GHRH receptor stimulation for sustained GH/IGF-1 elevation.
Research indications
What the compound has been studied for, grouped by body system. Effect size is the reported magnitude where it was measured — not a recommendation.
Continuous growth hormone release for 6-8 days per injection.
Significantly elevates IGF-1 levels for extended periods.
Weekly dosing ideal for simple administration.
Continuous GH elevation promotes lipolysis and fat metabolism.
Sustained anabolic environment supports muscle protein synthesis.
Accelerated healing and recovery from exercise or injury.
A large effect in a weak study and a small effect in a strong one are different things. Effect size is never evidence of use in people.
- Class
- GHRH analog with DAC
- Chain length
- 30 residues
- Molecular weight
- 3647.28 Da
- Half-life
- ~168 h
- Typical dose
- 1-2mg weekly
- Frequency
- Once or twice weekly (e.g., Monday/Thursday for split dosing)
- Cycle length
- 8-12 weeks
- Storage
- Lyophilized: 2-8°C refrigerated; Reconstituted: 2-8°C refrigerated, use within 30 days
Molecular data
- Type
- GHRH analog with DAC
- Molecular weight
- 3647.28 Da
- Chain length
- 30 residues
- Half-life
- 10080 min
YADAIFTNSYRKVLAQLSARKLLQDILSRKDosing reference
Doses reported in the literature and by suppliers. These are a record of what has been used in research — reference, never instruction.
| Context | Route | Amount | Frequency |
|---|---|---|---|
| Conservative Anti-Aging | SubQ | 1mg | Once weekly |
| Standard Protocol | SubQ | 2mg | Once weekly |
| Split Dosing | SubQ | 1mg | Twice weekly (Mon/Thu) |
| Loading Protocol | SubQ | 2mg first week, then 1mg | Weekly |
Interactions
Continuous GH elevation may reduce synergistic benefits of pulsatile protocols.
GHRP pulse effects diminished with continuous GH elevation.
Never combine different variants; choose based on desired release pattern.
Both provide continuous GH elevation; combination risks excessive levels.
Both are GHRH analogs; no additional benefit and potential receptor competition.
Defeats purpose and may suppress natural production.
CJC-1295 DAC is already more potent and long-lasting.
Quality checklist
- ✓High purity requirement (>98%); impurities cause more side effects
- ✓Proper DAC labeling; legitimate products clearly state 'with DAC'
- !Higher cost than non-DAC (2-3x more due to complex manufacturing)
- !Foaming during mixing is normal for DAC peptides; wait for foam to settle
- ×Extremely cheap pricing (if priced similar to non-DAC, likely mislabeled)
- ×Clear solution immediately (should be slightly cloudy initially)
What to expect
Safety
- Water retention
- Joint pain
- Carpal tunnel symptoms
- Severe joint pain or carpal tunnel syndrome
- Excessive water retention affecting daily life
- Numbness or tingling in extremities
- Significant blood glucose dysregulation
- Signs of acromegaly (jaw growth, hand/feet enlargement)
- Persistent lethargy indicating adrenal effects
- Diabetes history
- Cancer history
- Predisposed sleep apnea
FAQ
How much more expensive is CJC-1295 with DAC compared to without DAC?
CJC-1295 with DAC typically costs 2-3x more than the non-DAC version due to complex albumin-binding manufacturing. The higher cost reflects the DAC technology enabling weekly dosing versus daily injections required for the basic version, making weekly administration more convenient despite the price premium.
Is CJC-1295 with DAC safe to combine with testosterone therapy?
CJC-1295 with DAC can be used with testosterone but requires careful monitoring. Combining continuous GH elevation with exogenous testosterone increases risk of joint pain, water retention, and elevated IGF-1 beyond safe levels. Most protocols separate them or use lower doses of each when combined.
Why does some people report joint pain during CJC-1295 DAC use?
Joint pain and carpal tunnel symptoms occur due to sustained GH and IGF-1 elevation causing water retention in joints and connective tissues. Unlike pulsatile protocols where GH spikes then drops, the 6-8 day DAC half-life creates continuous elevation that may stress joints, particularly in high-dose users.
Can you switch between CJC-1295 with DAC and without DAC during a cycle?
Switching between variants mid-cycle is not recommended because they have different pharmacokinetics—DAC provides sustained elevation while non-DAC creates pulsatile release. Combining them risks excessive GH levels and unpredictable effects. Choose one variant at the start and maintain consistency throughout your cycle.
References
- 1Human Growth Hormone-Releasing Factor (hGRF)1-29-Albumin Bioconjugates Activate the GRF Receptor on the Anterior Pituitary in Rats: Identification of CJC-1295 as a Long-Lasting GRF AnalogJette L, Bhore R, Bhatt DL, et al. · Endocrinology · 2005
Identified CJC-1295 as a long-acting GHRH analog through albumin bioconjugation (DAC technology). Binds covalently to endogenous albumin, extending half-life from minutes to days.
animalPubMed 15817669 ↗ - 2Prolonged Stimulation of Growth Hormone (GH) and Insulin-Like Growth Factor I Secretion by CJC-1295, a Long-Acting Analog of GH-Releasing Hormone, in Healthy AdultsTeichman SL, Neale A, Lawrence B, Gagnon C, Castaigne JP, Bhore R · Journal of Clinical Endocrinology & Metabolism · 2006
Subcutaneous CJC-1295 produced sustained, dose-dependent increases in GH and IGF-1 in healthy adults. Half-life of ~8 days. Cumulative effect after multiple doses with well-preserved GH pulsatility.
human-pilotPubMed 16352683 ↗ - 3Pulsatile Secretion of Growth Hormone (GH) Persists During Continuous Stimulation by CJC-1295, a Long-Acting GH-Releasing Hormone AnalogIonescu M, Frohman LA · Journal of Clinical Endocrinology & Metabolism · 2006
Basal (trough) GH levels increased 7.5-fold. Mean GH levels increased 46% and IGF-1 levels increased 45%. Pulsatile GH secretion preserved despite continuous GHRH receptor stimulation.
reviewPubMed 17018654 ↗ - 4Activation of the GH/IGF-1 Axis by CJC-1295, a Long-Acting GHRH Analog, Results in Serum Protein Profile Changes in Normal Adult SubjectsTeichman SL, et al. · Growth Hormone & IGF Research · 2009
Long-acting GHRH stimulation via CJC-1295 produces measurable changes in serum protein profiles reflecting sustained GH/IGF-1 axis activation.
reviewPubMed 19386527 ↗